BIOLOGY HIGH SCHOOL

Which lists metric units, in order, from smallest to largest?kilogram, hectogram, decagram
decagram, decigram, centigram
milligram, centigram, decigram
decagram, hectogram, milligram

Answers

Answer 1
Answer:

Answer:

milligrams, centigrams, decigrams, kilograms, decagram,hectogram

Explanation:
Answer 2
Answer:

Answer:

milligram, centigram, decigram

Explanation:

Related Questions

Animals eat and digest food to obtain the energy available for life activities. Discuss energy use inanimals. In your discussion, be sure to:State one inference that can be made concerning a cell that has many of these organelles
Most deaths related to cardiovascular disease occur after what age?A. 20 years oldB. 40 years oldC. 60 years oldD. 80 years old
List the main features that define life in a material sense?
A DNA strand has the codon AAT. According to the chart, the corresponding messenger RNA codes for which amino acid?
The simplest operational cell is still more complex than a computer? 1)true 2) false

All matter is composed of tiny particles called

Answers

Are composed tiny particles called Atoms. Which are composed of neutrons, protons and electrons. 
Hope this is a successful answer!:)

Plant cells that are specialized for a cell division are most likely found in what part of a plant?

Answers

The Membrane is the answer

Identify a protein of interest (such as human insulin) and elaborate on the primary amino acid sequence of that protein. Include information such as the number of amino acids, the first dozen amino acids in the sequence, the molecular mass, is it a dimer, how many peptide chains are in the protein, where is it located, etc.

Answers

The pancreas produces the peptide hormone known as human insulin, which is essential for controlling blood sugar levels. There are two peptide chains in it, joined together by disulfide bonds.

An "A" chain and a "B" chain are the two peptide chains that make up human insulin. The A and B chains' amino acid sequences are arranged as follows:

A Chain (21 amino acids):

GIVEQCCTSICSLYQLENYCN

B Chain (30 amino acids):

FVNQHLCGSHLVEALYLVCGERGFFYTPKT

The 51 amino acids of human insulin make up the entire protein. Human insulin has a molecular mass of around 5808 Da (Daltons).

Dimer: Since human insulin is made up of two peptide chains (A and B chains) connected by disulfide bonds, it is a dimer.

Peptide Chains: The A chain and the B chain are the two peptide chains that make up human insulin.

Location: The beta cells of the pancreatic islets of Langerhans generate and secrete human insulin.

Learn more about amino acids:

brainly.com/question/31442968

Final answer:

Human insulin is a peptide hormone consisting of 51 amino acids across two chains. The primary amino acid sequence of chain A includes Gly, Ile, Val, and others. Insulin, a dimer, circulates in the bloodstream and binds to insulin receptors on cells.

Explanation:

The protein of interest I will elaborate on is human insulin. Insulin is a peptide hormone produced by beta cells in the pancreas. It has a total of 51 amino acids divided into two peptide chains linked by disulfide bridges, Chain A and Chain B. Chain A has 21 amino acids while Chain B has 30.

The primary amino acid sequence of chain A of human insulin starts with: Gly, Ile, Val, Glu, Gln, Cys, Cys, Thr, Ser, Ile, Cys, Ser. The molecular mass of insulin is approximately 5808 Da.

Insulin is a dimer in its storage form but functions as a monomer when it is actively binding to receptors. As it is a hormone, it circulates in the bloodstream and binds to insulin receptors on cells to promote glucose uptake.

Learn more about Human Insulin here:

brainly.com/question/3373845

#SPJ11

How is mass transit in cities a possible solution tk urban air pollution?

Answers

Mass transit can help reduce air pollution in urban cities because there are fewer cars on the roads, creating less pollution.

Which types of telescope use a mirror to bring light to focus?

Answers

Reflecting telescope. A reflecting telescope (also called a reflector) is an optical telescope which uses a single or combination of curved mirrors that reflect light and form an image.
A reflecting telescope.

Meristematic cells called the _____ add width to the plant body.shoot tip
root tip
vascular cambium
phloem

Answers


vascular cambium


Apical Meristems are found in the tips of the roots and in the buds of the shoots. They supply cells for the plants to grow in length.

Apical Meristems are found in herbaceous plants, woody plants, grasses, and flowering plants.

In flowering plants, shoot apical meristem develops into an inflorescence meristem which produces the floral meristem. The floral meristem is responsible for the production of the sepals, petals, stamens, and carpels of the flower.

The correct answer is C.
Other Questions
For the given quadratic equation convert into vertex form, find the vertex, and find the value for x=6. Show your work.y=-2x^2 + 2x+ 2
Group 1A element sodium combines with Group 7A element chlorine to form sodium chloride or table salt. Based on this information, This expression is true about the electronegativity values of these two elements.A) Na > Ci B) Na < Ci C) Na = Ci D) We cannot make a prediction with data provided.
What are the 4 stages of mitosis and what does each stage do?
Which regions make up the Sun's interior and surface? Select all of the answers that apply. photosphere corona core radiative zone chromosphere convective zone